Details of the Target
General Information of Target
| Target ID | LDTP16990 | |||||
|---|---|---|---|---|---|---|
| Target Name | Endogenous retrovirus group K member 25 Env polyprotein (ERVK-25) | |||||
| Gene Name | ERVK-25 | |||||
| Synonyms |
Endogenous retrovirus group K member 25 Env polyprotein; Envelope polyprotein; HERV-K_11q22.1 provirus ancestral Env polyprotein) [Cleaved into: Surface protein; SU; Transmembrane protein; TM)] |
|||||
| 3D Structure | ||||||
| Sequence |
MVRISKPKTFQAYLDDCHRRYSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCG
PAEERVLLTGLHAVADIHCENCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGWD |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Beta type-B retroviral envelope protein family, HERV class-II K(HML-2) env subfamily
|
|||||
| Subcellular location |
Virion; Cell membrane
|
|||||
| Function |
Retroviral envelope proteins mediate receptor recognition and membrane fusion during early infection. Endogenous envelope proteins may have kept, lost or modified their original function during evolution.; SU mediates receptor recognition.; TM anchors the envelope heterodimer to the viral membrane through one transmembrane domain. The other hydrophobic domain, called fusion peptide, mediates fusion of the viral membrane with the target cell membrane.
|
|||||
| Uniprot ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
 |
C104(0.00); C201(0.00); C335(0.00); C127(0.00) | LDD0161 | [1] | |