Details of the Target
General Information of Target
| Target ID | LDTP16988 | |||||
|---|---|---|---|---|---|---|
| Target Name | Zinc finger CCCH domain-containing protein 6 (ZC3H6) | |||||
| Gene Name | ZC3H6 | |||||
| Gene ID | 376940 | |||||
| Synonyms |
KIAA2035; ZC3HDC6; Zinc finger CCCH domain-containing protein 6 |
|||||
| 3D Structure | ||||||
| Sequence |
MKIPVLPAVVLLSLLVLHSAQGATLGGPEEESTIENYASRPEAFNTPFLNIDKLRSAFKA
DEFLNWHALFESIKRKLPFLNWDAFPKLKGLRSATPDAQ |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C339(0.90); C345(0.90) | LDD0078 | [1] | |
|
IA-alkyne Probe Info |
![]() |
C179(0.00); C159(0.00); C11(0.00) | LDD0161 | [2] | |
Competitor(s) Related to This Target
References


