Details of the Target
General Information of Target
Target ID | LDTP16967 | |||||
---|---|---|---|---|---|---|
Target Name | Putative heat shock 70 kDa protein 7 (HSPA7) | |||||
Gene Name | HSPA7 | |||||
Synonyms |
HSP70B; Putative heat shock 70 kDa protein 7; Heat shock 70 kDa protein B |
|||||
3D Structure | ||||||
Sequence |
MDPRECVCMSGGICMCGDNCKCTTCNCKTYWKSCCPCCPPGCAKCARGCICKGGSDKCSC
CP |
|||||
Target Bioclass |
Other
|
|||||
Family |
Heat shock protein 70 family
|
|||||
Uniprot ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
AZ-9 Probe Info |
![]() |
E317(1.00); D48(10.00) | LDD2208 | [1] | |
HHS-475 Probe Info |
![]() |
Y43(0.96) | LDD0264 | [2] | |
HHS-465 Probe Info |
![]() |
Y43(10.00) | LDD2237 | [3] | |
IA-alkyne Probe Info |
![]() |
C348(0.00); C27(0.00); C389(0.00); C506(0.00) | LDD0161 | [4] |
Competitor(s) Related to This Target
References