Details of the Target
General Information of Target
| Target ID | LDTP16961 | |||||
|---|---|---|---|---|---|---|
| Target Name | Melanoma-associated antigen 9 (MAGEA9; MAGEA9B) | |||||
| Gene Name | MAGEA9; MAGEA9B | |||||
| Gene ID | 4108 | |||||
| Synonyms |
MAGE9; MAGEA9A; Melanoma-associated antigen 9; Cancer/testis antigen 1.9; CT1.9; MAGE-9 antigen |
|||||
| 3D Structure | ||||||
| Sequence |
MSLEQKSQHCKPEEGLDTQEEALGLVGVQAATTEEQEAVSSSSPLVPGTLGEVPAAGSPG
PLKSPQGASAIPTAIDFTLWRQSIKGSSNQEEEGPSTSPDPESVFRAALSKKVADLIHFL LLKY |
|||||
| Target Bioclass |
Other
|
|||||
| Function | Not known, though may play a role in embryonal development and tumor transformation or aspects of tumor progression. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C299(1.07) | LDD3351 | [1] | |
|
IA-alkyne Probe Info |
 |
N.A. | LDD2241 | [2] | |
Competitor(s) Related to This Target
References