Details of the Target
General Information of Target
| Target ID | LDTP16868 | |||||
|---|---|---|---|---|---|---|
| Target Name | GATA-type zinc finger protein 1 (ZGLP1) | |||||
| Gene Name | ZGLP1 | |||||
| Gene ID | 100125288 | |||||
| Synonyms |
GLP1; GATA-type zinc finger protein 1; GATA-like protein 1; GLP-1 |
|||||
| 3D Structure | ||||||
| Sequence |
MGIPGLEGLHTWISIPFSFMYIVAVAGNIFLIFLIMTERSLHEPMYLFLSMLASADFLLA
TAAAPKVLAILWFHSMDISFGSCVSQMFFIHFIFVAESAILLAMAFDRYVAICYPLRYTI LTSSAVRKIGIAAVVRSFFICCPFIFLVYRLTYCGRNIIPHSYCEHIARLACGNINVNII YGLTVALLSTGLDIVLIIISYTMILHSVFQISSWAARFKALSTCGSHICVIFMFYTPAFF SFLAHRFGGKTIPHHIHILVGSLYVLVPPMLNPIIYGVKTKQIKDRVILLFSPISVCC |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Transcriptional regulator that plays a key role in germ cell development. Determines the oogenic fate by activating key genes for the oogenic program and meiotic prophase entry. Acts downstream of bone morphogenetic protein (BMP) by regulating expression of genes required for the oogenic programs, which are repressed by Polycomb activities in sexually uncommitted germ cells. Regulates expression of STRA8, a central downstream effector for the meiotic program. Acts independently of retinoic acid (RA). In males, not required for germ-cell sex determination, but required to allow the spermatogonia to efficiently accomplish the meiotic prophase.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0166 | [1] | |

