Details of the Target
General Information of Target
| Target ID | LDTP16860 | |||||
|---|---|---|---|---|---|---|
| Target Name | Putative protein N-methyltransferase FAM86B2 (FAM86B2) | |||||
| Gene Name | FAM86B2 | |||||
| Gene ID | 653333 | |||||
| Synonyms |
Putative protein N-methyltransferase FAM86B2; EC 2.1.1.- |
|||||
| 3D Structure | ||||||
| Sequence |
MISSVKLNLILVLSLSTMHVFWCYPVPSSKVSGKSDYFLILLNSCPTRLDRSKELAFLKP
ILEKMFVKRSFRNGVGTGMKKTSFQRAKS |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Class I-like SAM-binding methyltransferase superfamily, EEF2KMT family
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C72(1.92) | LDD0080 | [1] | |
|
IPM Probe Info |
![]() |
C290(0.00); C72(0.00) | LDD2156 | [2] | |
|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [3] | |
Competitor(s) Related to This Target
References



