Details of the Target
General Information of Target
| Target ID | LDTP16856 | |||||
|---|---|---|---|---|---|---|
| Target Name | P3 protein (SLC10A3) | |||||
| Gene Name | SLC10A3 | |||||
| Gene ID | 8273 | |||||
| Synonyms |
DXS253E; P3; P3 protein; Solute carrier family 10 member 3 |
|||||
| 3D Structure | ||||||
| Sequence |
DKQLDADVSPKPTIFLPSIAETKLQKAGTYLCLLEKFFPDIIKIHWQEKKSNTILGSQEG
NTMKTNDTYMKFSWLTVPEESLDKEHRCIVRHENNKNGIDQEIIFPPIKTDVTTVDPKYN YSKDANDVITMDPKDNWSKDANDTLLLQLTNTSAYYTYLLLLLKSVVYFAIITCCLLRRT AFCCNGEKS |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Bile acid:sodium symporter (BASS) (TC 2.A.28) family
|
|||||
| Subcellular location |
Membrane
|
|||||
| Function | The ubiquitous expression and the conservation of the sequence in distant animal species suggest that the gene codes for a protein with housekeeping functions. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
 |
C23(0.00); C94(0.00); C43(0.00); C908(0.00) | LDD0161 | [1] | |