Details of the Target
General Information of Target
| Target ID | LDTP16853 | |||||
|---|---|---|---|---|---|---|
| Target Name | Protein phosphatase 1 regulatory subunit 17 (PPP1R17) | |||||
| Gene Name | PPP1R17 | |||||
| Gene ID | 10842 | |||||
| Synonyms |
C7orf16; GSBS; Protein phosphatase 1 regulatory subunit 17; G-substrate |
|||||
| 3D Structure | ||||||
| Sequence |
MKLSVCLLLVTLALCCYQANAEFCPALVSELLDFFFISEPLFKLSLAKFDAPPEAVAAKL
GVKRCTDQMSLQKRSLIAEVLVKILKKCSV |
|||||
| Target Bioclass |
Other
|
|||||
| Function | Inhibits phosphatase activities of protein phosphatase 1 (PP1) and protein phosphatase 2A (PP2A) complexes. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
C839(0.00); C108(0.00); C118(0.00); C426(0.00) | LDD0161 | [1] | |

