Details of the Target
General Information of Target
| Target ID | LDTP16833 | |||||
|---|---|---|---|---|---|---|
| Target Name | Olfactory receptor 7A10 (OR7A10) | |||||
| Gene Name | OR7A10 | |||||
| Gene ID | 390892 | |||||
| Synonyms |
Olfactory receptor 7A10; OST027; Olfactory receptor OR19-18 |
|||||
| 3D Structure | ||||||
| Sequence |
MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGE
DEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC |
|||||
| Target Bioclass |
GPCR
|
|||||
| Family |
G-protein coupled receptor 1 family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function | Odorant receptor. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
C209(0.00); C108(0.00) | LDD0161 | [1] | |

