Details of the Target
General Information of Target
| Target ID | LDTP16788 | |||||
|---|---|---|---|---|---|---|
| Target Name | Protein phosphatase inhibitor 2 family member C (PPP1R2C) | |||||
| Gene Name | PPP1R2C | |||||
| Synonyms |
PPP1R2P9; Protein phosphatase inhibitor 2 family member C; PPP1R2 family member B; Protein phosphatase 1, regulatory subunit 2 pseudogene 9; Type-1 protein phosphatase inhibitor 4; I-4 |
|||||
| 3D Structure | ||||||
| Sequence |
MSRRNCWICKMCRDESKRPPSNLTLEEVLQWAQSFENLMATKYGPVVYAAYLKMEHSDEN
IQFWMACETYKKIASRWSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETC FEEAQKIVYMHMERDSYPRFLKSEMYQKLLKTMQSNNSF |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Protein phosphatase inhibitor 2 family
|
|||||
| Function | Functions as a protein phosphatase inhibitor. It inhibits activity of the catalytic subunit of PP1 and weakly inhibits the activity of myosin-associated phosphates. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
C65(0.00); C320(0.00); C157(0.00) | LDD0161 | [1] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme

