Details of the Target
General Information of Target
| Target ID | LDTP16785 | |||||
|---|---|---|---|---|---|---|
| Target Name | Thymosin beta-4, Y-chromosomal (TMSB4Y) | |||||
| Gene Name | TMSB4Y | |||||
| Gene ID | 9087 | |||||
| Synonyms |
TB4Y; Thymosin beta-4, Y-chromosomal |
|||||
| 3D Structure | ||||||
| Sequence |
MSPKPRASGPPAKAKETGKRKSSSQPSPSGPKKKTTKVAEKGEAVRGGRRGKKGAATKMA
AVTAPEAESGPAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPLSQESELEEPLSKGRPS TPLSP |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Thymosin beta family
|
|||||
| Subcellular location |
Cytoplasm, cytoskeleton
|
|||||
| Function | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
AZ-9 Probe Info |
 |
E22(0.92) | LDD2208 | [1] | |
|
Acrolein Probe Info |
 |
N.A. | LDD0230 | [2] | |
|
IA-alkyne Probe Info |
 |
N.A. | LDD0161 | [3] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
References