Details of the Target
General Information of Target
| Target ID | LDTP16780 | |||||
|---|---|---|---|---|---|---|
| Target Name | Netrin-3 (NTN3) | |||||
| Gene Name | NTN3 | |||||
| Gene ID | 4917 | |||||
| Synonyms |
NTN2L; Netrin-3; Netrin-2-like protein |
|||||
| 3D Structure | ||||||
| Sequence |
MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKA
DAGKDGNNPAKNRDASTLQSQKAEGTGDAK |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Subcellular location |
Secreted, extracellular space, extracellular matrix
|
|||||
| Function | Netrins control guidance of CNS commissural axons and peripheral motor axons. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
 |
N.A. | LDD0161 | [1] | |
The Interaction Atlas With This Target