Details of the Target
General Information of Target
| Target ID | LDTP16778 | |||||
|---|---|---|---|---|---|---|
| Target Name | Putative transcription factor ovo-like protein 3 (OVOL3) | |||||
| Gene Name | OVOL3 | |||||
| Gene ID | 728361 | |||||
| Synonyms |
Putative transcription factor ovo-like protein 3 |
|||||
| 3D Structure | ||||||
| Sequence |
MPSRGTRPEDSSVLIPTDNSTPHKEDLSSKIKEQKIVVDELSNLKKNRKVYRQQQNSNIF
FLADRTEMLSESKNILDELKKEYQEIENLDKTKIKK |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
Krueppel C2H2-type zinc-finger protein family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function | May act as a transcription regulator. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
C944(0.00); C180(0.00); C319(0.00); C305(0.00) | LDD0161 | [1] | |

