Details of the Target
General Information of Target
| Target ID | LDTP16764 | |||||
|---|---|---|---|---|---|---|
| Target Name | NADH dehydrogenase [ubiquinone] 1 subunit C2 (NDUFC2-KCTD14) | |||||
| Gene Name | NDUFC2-KCTD14 | |||||
| Gene ID | 100532726 | |||||
| Synonyms |
NADH dehydrogenase [ubiquinone] 1 subunit C2, isoform 2; NDUFC2-KCTD14 readthrough transcript protein |
|||||
| 3D Structure | ||||||
| Sequence |
MFSLPLNCSPDHIRRGSCWGRPQDLKIAAPAWNSKCHPGAGAAMARQHARTLWYDRPRYV
FMEFCVEDSTDVHVLIEDHRIVFSCKNADGVELYNEIEFYAKVNSKPVWLSVDFDNWRDW EGDEEMELAHVEHYAELLKKVSTKRPPPAMDDLDDDSDSADDATSN |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Complex I NDUFC2 subunit family
|
|||||
| Subcellular location |
Mitochondrion inner membrane
|
|||||
| Function |
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0162 | [1] | |
|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [2] | |
References


