Details of the Target
General Information of Target
| Target ID | LDTP16738 | |||||
|---|---|---|---|---|---|---|
| Target Name | Apical junction component 1 homolog (AJM1) | |||||
| Gene Name | AJM1 | |||||
| Gene ID | 389813 | |||||
| Synonyms |
C9orf172; Apical junction component 1 homolog |
|||||
| 3D Structure | ||||||
| Sequence |
MIQQEEIRKLEEEKKQLEGEIIDFYKMKAASEALQTQLSTDTKKDKHPDPYEFLLLRKIK
HPGFNEELSPC |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Apical cell membrane
|
|||||
| Function | May be involved in the control of adherens junction integrity. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C726(2.27) | LDD2469 | [1] | |
Competitor(s) Related to This Target

