Details of the Target
General Information of Target
| Target ID | LDTP16734 | |||||
|---|---|---|---|---|---|---|
| Target Name | Transmembrane protein 150C (TMEM150C) | |||||
| Gene Name | TMEM150C | |||||
| Gene ID | 441027 | |||||
| Synonyms |
Transmembrane protein 150C |
|||||
| 3D Structure | ||||||
| Sequence |
MRPKTGQVGCETPEELGPGPRQRWPLLLLGLAMVAHGLLRPMVAPQSGDPDPGASVGSSR
SSLRSLWGRLLLQPSPQRADPRCWPRGFWSEPQSLCYVFGTGTKVTVLGQPKANPTVTLF PPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYL SLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
DRAM/TMEM150 family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function | Component of a mechanosensitive cation channel. Confers mechanically activated (MA) currents with slow inactivation kinetics. May contribute to proprioception. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [1] | |

