Details of the Target
General Information of Target
| Target ID | LDTP16543 | |||||
|---|---|---|---|---|---|---|
| Target Name | Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5B (GNG5B) | |||||
| Gene Name | GNG5B | |||||
| Synonyms |
GNG5P2; Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5B |
|||||
| 3D Structure | ||||||
| Sequence |
MLSLLLLLLGLGSVFSAVISQKPSRDICQRGTSLTIQCQVDSQVTMMFWYRQQPGQSLTL
IATANQGSEATYESGFVIDKFPISRPNLTFSTLTVSNMSPEDSSIYLCSVE |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
G protein gamma family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [1] | |

