Details of the Target
General Information of Target
Target ID | LDTP16543 | |||||
---|---|---|---|---|---|---|
Target Name | Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5B (GNG5B) | |||||
Gene Name | GNG5B | |||||
Synonyms |
GNG5P2; Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5B |
|||||
3D Structure | ||||||
Sequence |
MLSLLLLLLGLGSVFSAVISQKPSRDICQRGTSLTIQCQVDSQVTMMFWYRQQPGQSLTL
IATANQGSEATYESGFVIDKFPISRPNLTFSTLTVSNMSPEDSSIYLCSVE |
|||||
Target Bioclass |
Other
|
|||||
Family |
G protein gamma family
|
|||||
Subcellular location |
Cell membrane
|
|||||
Function |
Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [1] |