Details of the Target
General Information of Target
| Target ID | LDTP16271 | |||||
|---|---|---|---|---|---|---|
| Target Name | Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform (PPP2R2C) | |||||
| Gene Name | PPP2R2C | |||||
| Gene ID | 5522 | |||||
| Synonyms |
Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform; IMYPNO1; PP2A subunit B isoform B55-gamma; PP2A subunit B isoform PR55-gamma; PP2A subunit B isoform R2-gamma; PP2A subunit B isoform gamma
|
|||||
| 3D Structure | ||||||
| Sequence |
MAAPAVKVARGWSGLALGVRRAVLQLPGLTQVRWSRYSPEFKDPLIDKEYYRKPVEELTE
EEKYVRELKKTQLIKAAPAGKTSSVFEDPVISKFTNMMMIGGNKVLARSLMIQTLEAVKR KQFEKYHAASAEEQATIERNPYTIFHQALKNCEPMIGLVPILKGGRFYQVPVPLPDRRRR FLAMKWMITECRDKKHQRTLMPEKLSHKLLEAFHNQGPVIKRKHDLHKMAEANRALAHYR WW |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Phosphatase 2A regulatory subunit B family
|
|||||
| Function | The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
BTD Probe Info |
![]() |
C258(0.69) | LDD2091 | [1] | |
|
4-Iodoacetamidophenylacetylene Probe Info |
![]() |
N.A. | LDD0038 | [2] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0036 | [2] | |
|
WYneN Probe Info |
![]() |
N.A. | LDD0021 | [3] | |
|
W1 Probe Info |
![]() |
N.A. | LDD0236 | [4] | |
|
HHS-465 Probe Info |
![]() |
N.A. | LDD2240 | [5] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
References






