Details of the Target
General Information of Target
| Target ID | LDTP16244 | |||||
|---|---|---|---|---|---|---|
| Target Name | Protocadherin beta-8 (PCDHB8) | |||||
| Gene Name | PCDHB8 | |||||
| Gene ID | 56128 | |||||
| Synonyms |
PCDH3I; Protocadherin beta-8; PCDH-beta-8; Protocadherin-3I |
|||||
| 3D Structure | ||||||
| Sequence |
MRASPCISQPAASWHPRPSALRPTAGSGPDTRTPGTVEDGSAPCPAFRSPAVSPCGEEPC
CFQISPAEETLELGRLVSPGNCDTLSPRAAGFYACHVRSLIPCRSTKGRWPLTASAAGLS SFSG |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
Calcium-dependent cell-adhesion protein involved in cells self-recognition and non-self discrimination. Thereby, it is involved in the establishment and maintenance of specific neuronal connections in the brain.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C384(1.51) | LDD3344 | [1] | |
Competitor(s) Related to This Target