Details of the Target
General Information of Target
| Target ID | LDTP16176 | |||||
|---|---|---|---|---|---|---|
| Target Name | Protein unc-79 homolog (UNC79) | |||||
| Gene Name | UNC79 | |||||
| Gene ID | 57578 | |||||
| Synonyms |
KIAA1409; Protein unc-79 homolog |
|||||
| 3D Structure | ||||||
| Sequence |
MQRPEAWPRPHPGEGAAAAQAGGPAPPARAGEPSGLRLQEPSLYTIKAVFILDNDGRRLL
AKYYDDTFPSMKEQMVFEKNVFNKTSRTESEIAFFGGMTIVYKNSIDLFLYVVGSSYENE LMLMSVLTCLFESLNHMLRKNVEKRWLLENMDGAFLVLDEIVDGGVILESDPQQVIQKVN FRADDGGLTEQSVAQVLQSAKEQIKWSLLK |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Unc-79 family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
Auxiliary subunit of the NALCN sodium channel complex, a voltage-gated ion channel responsible for the resting Na(+) permeability that controls neuronal excitability. Activated by neuropeptides substance P, neurotensin, and extracellular calcium that regulates neuronal excitability by controlling the sizes of NALCN-dependent sodium-leak current.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0166 | [1] | |

