Details of the Target
General Information of Target
| Target ID | LDTP16082 | |||||
|---|---|---|---|---|---|---|
| Target Name | Sperm protein associated with the nucleus on the X chromosome A (SPANXA1; SPANXA2) | |||||
| Gene Name | SPANXA1; SPANXA2 | |||||
| Gene ID | 30014 | |||||
| Synonyms |
SPANXA; Sperm protein associated with the nucleus on the X chromosome A; Cancer/testis antigen 11.1; CT11.1; Nuclear-associated protein SPAN-Xa; SPAN-X; SPANX-A; SPANX family member A |
|||||
| 3D Structure | ||||||
| Sequence |
MGQQSSVRRLKRSVPCESNEANEANEANKTMPETPTGDSDPQPAPKKMKTSESSTILVVR
YRRNVKRTSPEELLNDHARENRINPDQMEEEEFIEITTERPKK |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
SPAN-X family
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C16(1.43) | LDD3462 | [1] | |
Competitor(s) Related to This Target