Details of the Target
General Information of Target
| Target ID | LDTP16077 | |||||
|---|---|---|---|---|---|---|
| Target Name | Metal transporter CNNM1 (CNNM1) | |||||
| Gene Name | CNNM1 | |||||
| Gene ID | 26507 | |||||
| Synonyms |
ACDP1; Metal transporter CNNM1; Ancient conserved domain-containing protein 1; Cyclin-M1 |
|||||
| 3D Structure | ||||||
| Sequence |
MRTPGPLPVLLLLLAGAPAARPTPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPR
LYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNA LEYPIPVTTVLPDRQR |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
ACDP family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function | Probable metal transporter. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C733(1.87) | LDD3483 | [1] | |
|
IPM Probe Info |
![]() |
C733(2.36) | LDD1702 | [2] | |
Competitor(s) Related to This Target
References


