Details of the Target
General Information of Target
| Target ID | LDTP16051 | |||||
|---|---|---|---|---|---|---|
| Target Name | Endogenous retrovirus group K member 5 Gag polyprotein (ERVK-5) | |||||
| Gene Name | ERVK-5 | |||||
| Synonyms |
ERVK5; Endogenous retrovirus group K member 5 Gag polyprotein; HERV-K(II) Gag protein; HERV-K_3q12.3 provirus ancestral Gag polyprotein; Gag polyprotein |
|||||
| 3D Structure | ||||||
| Sequence |
MESPKKKNQQLKVGILHLGSRQKKIRIQLRSQCATWKVICKSCISQTPGINLDLGSGVKV
KIIPKEEHCKMPEAGEEQPQV |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Beta type-B retroviral Gag protein family, HERV class-II K(HML-2) gag subfamily
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
The products of the Gag polyproteins of infectious retroviruses perform highly complex orchestrated tasks during the assembly, budding, maturation, and infection stages of the viral replication cycle. During viral assembly, the proteins form membrane associations and self-associations that ultimately result in budding of an immature virion from the infected cell. Gag precursors also function during viral assembly to selectively bind and package two plus strands of genomic RNA. Endogenous Gag proteins may have kept, lost or modified their original function during evolution.
|
|||||
| Uniprot ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
BTD Probe Info |
![]() |
C558(1.17) | LDD2135 | [1] | |
Competitor(s) Related to This Target

