Details of the Target
General Information of Target
| Target ID | LDTP16001 | |||||
|---|---|---|---|---|---|---|
| Target Name | IGF-like family receptor 1 (IGFLR1) | |||||
| Gene Name | IGFLR1 | |||||
| Gene ID | 79713 | |||||
| Synonyms |
TMEM149; U2AF1L4; IGF-like family receptor 1; Transmembrane protein 149; U2 small nuclear RNA auxiliary factor 1-like 4 |
|||||
| 3D Structure | ||||||
| Sequence |
MEDPNPEENMKQQDSPKERSPQSPGGNICHLGAPKCTRCLITFADSKFQERHMKREHPAD
FVAQKLQGVLFICFTCARSFPSSKALITHQRSHGPAAKPTLPVATTTAQPTFPCPDCGKT FGQAVSLRRHRQMHEVRAPPGTFACTECGQDFAQEAGLHQHYIRHARGEL |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function | Probable cell membrane receptor for the IGF-like family proteins. Binds IGFL1 and IGFL3 with a higher affinity. May also bind IGFL2. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
C42(8.35) | LDD2157 | [1] | |
The Interaction Atlas With This Target

