Details of the Target
General Information of Target
| Target ID | LDTP15996 | |||||
|---|---|---|---|---|---|---|
| Target Name | Serine hydrolase-like protein 2 (SERHL2) | |||||
| Gene Name | SERHL2 | |||||
| Gene ID | 253190 | |||||
| Synonyms |
SERHL; Serine hydrolase-like protein 2; EC 3.1.-.- |
|||||
| 3D Structure | ||||||
| Sequence |
MLGLPWKGGLSWALLLLLLGSQILLIYAWHFHEQRDCDEHNVMARYLPATVEFAVHTFNQ
QSKDYYAYRLGHILNSWKEQVESKTVFSMELLLGRTRCGKFEDDIDNCHFQESTELNNTF TCFFTISTRPWMTQFSLLNKTCLEGFH |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
AB hydrolase superfamily
|
|||||
| Subcellular location |
Cytoplasm, perinuclear region
|
|||||
| Function | Probable serine hydrolase. May be related to cell muscle hypertrophy. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C49(3.88) | LDD3493 | [1] | |
Competitor(s) Related to This Target

