Details of the Target
General Information of Target
| Target ID | LDTP15894 | |||||
|---|---|---|---|---|---|---|
| Target Name | Coiled-coil domain-containing protein 32 (CCDC32) | |||||
| Gene Name | CCDC32 | |||||
| Gene ID | 90416 | |||||
| Synonyms |
C15orf57; Coiled-coil domain-containing protein 32 |
|||||
| 3D Structure | ||||||
| Sequence |
MEDAAAPGRTEGVLERQGAPPAAGQGGALVELTPTPGGLALVSPYHTHRAGDPLDLVALA
EQVQKADEFIRANATNKLTVIAEQIQHLQEQARKVLEDAHRDANLHHVACNIVKKPGNIY YLYKRESGQQYFSIISPKEWGTSCPHDFLGAYKLQHDLSWTPYEDIEKQDAKISMMDTLL SQSVALPPCTEPNFQGLTH |
|||||
| Target Bioclass |
Other
|
|||||
| Function |
Regulates clathrin-mediated endocytsois of cargos such as transferrin probably through the association and modulation of adaptor protein complex 2 (AP-2). Has a role in ciliogenesis. Required for proper cephalic and left/right axis development.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K108(10.00); K89(5.00) | LDD0277 | [1] | |
|
IA-alkyne Probe Info |
![]() |
C25(12.19); C47(12.19) | LDD1710 | [2] | |
|
Methacrolein Probe Info |
![]() |
N.A. | LDD0218 | [3] | |
|
AOyne Probe Info |
![]() |
15.00 | LDD0443 | [4] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Heat shock protein HSP 90-alpha (HSP90AA1) | Heat shock protein 90 family | P07900 | |||
| tRNA modification GTPase GTPBP3, mitochondrial (GTPBP3) | TrmE GTPase family | Q969Y2 | |||
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Protection of telomeres protein 1 (POT1) | Telombin family | Q9NUX5 | |||
References




