Details of the Target
General Information of Target
| Target ID | LDTP15855 | |||||
|---|---|---|---|---|---|---|
| Target Name | PH and SEC7 domain-containing protein 2 (PSD2) | |||||
| Gene Name | PSD2 | |||||
| Gene ID | 84249 | |||||
| Synonyms |
EFA6C; PH and SEC7 domain-containing protein 2; Exchange factor for ADP-ribosylation factor guanine nucleotide factor 6 C; Exchange factor for ARF6 C; Pleckstrin homology and SEC7 domain-containing protein 2
|
|||||
| 3D Structure | ||||||
| Sequence |
MFLTALLWRGRIPGRQWIGKHRRPRFVSLRAKQNMIRRLEIEAENHYWLSMPYMTREQER
GHAAVRRREAFEAIKAAATSKFPPHRFIADQLDHLNVTKKWS |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
PSD family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C679(1.10) | LDD2279 | [1] | |
Competitor(s) Related to This Target

