Details of the Target
General Information of Target
| Target ID | LDTP15807 | |||||
|---|---|---|---|---|---|---|
| Target Name | Zinc finger imprinted 3 (ZIM3) | |||||
| Gene Name | ZIM3 | |||||
| Gene ID | 114026 | |||||
| Synonyms |
ZNF657; Zinc finger imprinted 3; Zinc finger protein 657 |
|||||
| 3D Structure | ||||||
| Sequence |
MSFSLNFTLPANTTSSPVTGGKETDCGPSLGLAAGIPLLVATALLVALLFTLIHRRRSSI
EAMEESDRPCEISEIDDNPKISENPRRSPTHEKNTMGAQEAHIYVKTVAGSEEPVHDRYR PTIEMERRRGLWWLVPRLSLE |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
Krueppel C2H2-type zinc-finger protein family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function | May be involved in transcriptional regulation. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K97(8.33) | LDD0277 | [1] | |
|
N1 Probe Info |
![]() |
C393(0.00); E392(0.00); N394(0.00) | LDD0245 | [2] | |
|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [3] | |
|
HHS-465 Probe Info |
![]() |
K333(0.00); K336(0.00); Y335(0.00) | LDD2240 | [4] | |
The Interaction Atlas With This Target
References




