Details of the Target
General Information of Target
| Target ID | LDTP15790 | |||||
|---|---|---|---|---|---|---|
| Target Name | Cilia- and flagella-associated protein 54 (CFAP54) | |||||
| Gene Name | CFAP54 | |||||
| Gene ID | 144535 | |||||
| Synonyms |
C12orf55; C12orf63; Cilia- and flagella-associated protein 54 |
|||||
| 3D Structure | ||||||
| Sequence |
MVTHAAGARTFCEEQKKGSTYSVPKSKEKLMEKHSQEARQADRESEKPVDSLHPGAGTAK
HPPPAASLEEKPDVKQKSSRKKVVVPQIIITRASNETLVSCSSSGSDQQRTIREPEDWGP YRRHRNPSTADAYNSHLKE |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
CFAP54 family
|
|||||
| Subcellular location |
Cytoplasm, cytoskeleton, cilium axoneme
|
|||||
| Function | Required for assembly and function of cilia and flagella. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
Acrolein Probe Info |
![]() |
N.A. | LDD0217 | [1] | |
Competitor(s) Related to This Target

