Details of the Target
General Information of Target
| Target ID | LDTP15774 | |||||
|---|---|---|---|---|---|---|
| Target Name | Apolipoprotein L domain-containing protein 1 (APOLD1) | |||||
| Gene Name | APOLD1 | |||||
| Gene ID | 81575 | |||||
| Synonyms |
VERGE; Apolipoprotein L domain-containing protein 1; Vascular early response gene protein |
|||||
| 3D Structure | ||||||
| Sequence |
MGAGVGVAGCTRGHRNWVPSQLPPREIKAGVSLAVVTEFAWVLAPRPKRATASALGTESP
RFLDRPDFFDYPDSDQARLLAVAQFIGEKPIVFINSGSSPGLFHHILVGLLVVAFFFLLF QFCTHINFQKGA |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Apolipoprotein L family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function | May be involved in angiogenesis. May play a role in activity-dependent changes of brain vasculature. May affect blood-brain permeability. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C258(2.87) | LDD2329 | [1] | |
Competitor(s) Related to This Target