Details of the Target
General Information of Target
| Target ID | LDTP15747 | |||||
|---|---|---|---|---|---|---|
| Target Name | Cysteine and tyrosine-rich protein 1 (CYYR1) | |||||
| Gene Name | CYYR1 | |||||
| Gene ID | 116159 | |||||
| Synonyms |
C21orf95; Cysteine and tyrosine-rich protein 1; Proline-rich domain-containing protein |
|||||
| 3D Structure | ||||||
| Sequence |
MGTRTLQFEISDSHEKEEDLLHKNHLMQDEIARLRLEIHTIKNQILEKKYLKDIEIIKRK
HEDLQKALKQNGEKSTKTIAHYSGQLTALTDENTMLRSKLEKEKQSRQRLTKWNHTIVD |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
CYYR1 family
|
|||||
| Subcellular location |
Membrane
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
BTD Probe Info |
 |
C31(0.53) | LDD2100 | [1] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0548 | 1-(4-(Benzo[d][1,3]dioxol-5-ylmethyl)piperazin-1-yl)-2-nitroethan-1-one | MDA-MB-231 | C31(0.60) | LDD2142 | [1] |
| LDCM0507 | Nucleophilic fragment 16b | MDA-MB-231 | C31(0.53) | LDD2100 | [1] |
| LDCM0513 | Nucleophilic fragment 19b | MDA-MB-231 | C31(0.52) | LDD2106 | [1] |
| LDCM0515 | Nucleophilic fragment 20b | MDA-MB-231 | C31(0.99) | LDD2108 | [1] |
| LDCM0547 | Nucleophilic fragment 41 | MDA-MB-231 | C31(1.07) | LDD2141 | [1] |