Details of the Target
General Information of Target
| Target ID | LDTP15736 | |||||
|---|---|---|---|---|---|---|
| Target Name | SH3 domain-containing YSC84-like protein 1 (SH3YL1) | |||||
| Gene Name | SH3YL1 | |||||
| Gene ID | 26751 | |||||
| Synonyms |
SH3 domain-containing YSC84-like protein 1 |
|||||
| 3D Structure | ||||||
| Sequence |
MAALGSPSHTFRGLLRELRYLSAATGRPYRDTAAYRYLVKAFRAHRVTSEKLCRAQHELH
FQAATYLCLLRSIRKHVALHQEFHGKGERSVEESAGLVGLKLPHQPGGKGWEP |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
SH3YL1 family
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C57(2.27) | LDD2268 | [1] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0162 | [2] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Zinc finger and BTB domain-containing protein 7B (ZBTB7B) | . | O15156 | |||
Other
References


