Details of the Target
General Information of Target
| Target ID | LDTP15731 | |||||
|---|---|---|---|---|---|---|
| Target Name | Uncharacterized protein C16orf74 (C16orf74) | |||||
| Gene Name | C16orf74 | |||||
| Gene ID | 404550 | |||||
| Synonyms |
Uncharacterized protein C16orf74 |
|||||
| 3D Structure | ||||||
| Sequence |
MEEISLANLDTNKLEAIAQEIYVDLIEDSCLGFCFEVHRAVKCGYFYLEFAETGSVKDFG
IQPVEDKGACRLPLCSLPGEPGNGPDQQLQRSPPEFQ |
|||||
| Target Bioclass |
Other
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IPM Probe Info |
![]() |
N.A. | LDD2156 | [1] | |
The Interaction Atlas With This Target

