Details of the Target
General Information of Target
| Target ID | LDTP15723 | |||||
|---|---|---|---|---|---|---|
| Target Name | Kinesin-like protein KIF12 (KIF12) | |||||
| Gene Name | KIF12 | |||||
| Gene ID | 113220 | |||||
| Synonyms |
Kinesin-like protein KIF12 |
|||||
| 3D Structure | ||||||
| Sequence |
MEEPEMQLKGKKVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQS
QGAIYTVEYACSAVKNLVDSSVYFRSVEGLLKQAISIRDHMNASAQGHSPEEPPPPSSA |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
TRAFAC class myosin-kinesin ATPase superfamily, Kinesin family
|
|||||
| Subcellular location |
Cytoplasm, cytoskeleton
|
|||||
| Uniprot ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C632(3.13) | LDD3389 | [1] | |
|
N1 Probe Info |
![]() |
S171(0.00); S174(0.00) | LDD0245 | [2] | |
Competitor(s) Related to This Target
References


