Details of the Target
General Information of Target
| Target ID | LDTP15673 | |||||
|---|---|---|---|---|---|---|
| Target Name | Glycine N-acyltransferase-like protein 1 (GLYATL1) | |||||
| Gene Name | GLYATL1 | |||||
| Gene ID | 92292 | |||||
| Synonyms |
GNAT; Glycine N-acyltransferase-like protein 1; EC 2.3.1.68; Acyl-CoA:glycine N-acyltransferase-like protein 1; Glutamine N-acyltransferase |
|||||
| 3D Structure | ||||||
| Sequence |
MWHLKLCAVLMIFLLLLGQIDGSPIPEVSSAKRRPRRMTPFWRGVSLRPIGASCRDDSEC
ITRLCRKRRCSLSVAQE |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Glycine N-acyltransferase family
|
|||||
| Function | Acyltransferase which transfers an acyl group to the N-terminus of glutamine. Can use phenylacetyl-CoA as an acyl donor. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C92(2.31) | LDD3395 | [1] | |
|
SF Probe Info |
![]() |
N.A. | LDD0028 | [2] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
References


