Details of the Target
General Information of Target
| Target ID | LDTP15643 | |||||
|---|---|---|---|---|---|---|
| Target Name | Zinc finger protein 606 (ZNF606) | |||||
| Gene Name | ZNF606 | |||||
| Gene ID | 80095 | |||||
| Synonyms |
KIAA1852; ZNF328; Zinc finger protein 606; Zinc finger protein 328 |
|||||
| 3D Structure | ||||||
| Sequence |
MDKSLLLELPILLCCFRALSGSLSMRNDAVNEIVAVKNNFPVIEIVQCRMCHLQFPGEKC
SRGRGICTATTEEACMVGRMFKRDGNPWLTFMGCLKNCADVKGIRWSVYLVNFRCCRSHD LCNEDL |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
Krueppel C2H2-type zinc-finger protein family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function | May act as a transcriptional repressor. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K160(5.00) | LDD0277 | [1] | |
|
DBIA Probe Info |
![]() |
C261(2.33) | LDD3319 | [2] | |
|
HHS-465 Probe Info |
![]() |
K678(0.00); K681(0.00); Y680(0.00) | LDD2240 | [3] | |
Competitor(s) Related to This Target
References



