Details of the Target
General Information of Target
| Target ID | LDTP15639 | |||||
|---|---|---|---|---|---|---|
| Target Name | GRB2-associated-binding protein 3 (GAB3) | |||||
| Gene Name | GAB3 | |||||
| Gene ID | 139716 | |||||
| Synonyms |
GRB2-associated-binding protein 3; GRB2-associated binder 3; Growth factor receptor bound protein 2-associated protein 3 |
|||||
| 3D Structure | ||||||
| Sequence |
MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSN
LFEAFVALAVLVTLIIGAFYFLCRKGHFQRASSVQYDINLVETSSTSAHHSHEQH |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
GAB family
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
C336(7.47) | LDD1705 | [1] | |
Competitor(s) Related to This Target

