Details of the Target
General Information of Target
| Target ID | LDTP15635 | |||||
|---|---|---|---|---|---|---|
| Target Name | Ankyrin repeat domain-containing protein 49 (ANKRD49) | |||||
| Gene Name | ANKRD49 | |||||
| Gene ID | 54851 | |||||
| Synonyms |
FGIF; Ankyrin repeat domain-containing protein 49; Fetal globin-inducing factor |
|||||
| 3D Structure | ||||||
| Sequence |
MFTRAQVRRILQRVPGKQRFGIYRFLPFFFVLGGTMEWIMIKVRVGQETFYDVYRRKASE
RQYQRRLEDE |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function | Induces HBG1 expression. May have a role in spermatogenesis where it promotes autophagy in response to serum starvation, via the NF-kappaB pathway. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
 |
N.A. | LDD2241 | [1] | |