Details of the Target
General Information of Target
| Target ID | LDTP15591 | |||||
|---|---|---|---|---|---|---|
| Target Name | Probable RNA-binding protein 46 (RBM46) | |||||
| Gene Name | RBM46 | |||||
| Gene ID | 166863 | |||||
| Synonyms |
Probable RNA-binding protein 46; Cancer/testis antigen 68; CT68; RNA-binding motif protein 46 |
|||||
| 3D Structure | ||||||
| Sequence |
MSAIFNFQSLLTVILLLICTCAYIRSLAPSLLDRNKTGLLGIFWKCARIGERKSPYVAVC
CIVMAFSILFIQ |
|||||
| Target Bioclass |
Other
|
|||||
| Function |
Essential for male and female fertility, playing a crucial role in regulating germ cell development by ensuring the proper progression of meiosis prophase I. Regulates mitotic-to-meiotic transition in spermatogenesis by forming a complex with MEIOC and YTHDC2 which recognizes and down-regulates mitotic transcripts for a successful meiotic entry. Required for normal synaptonemal complex formation during meiosis, binding meiotic cohesin subunit mRNAs containing GCCUAU/GUUCGA motifs in their 3'UTRs regions and positively regulating their translation. Required for spermatogonial differentiation in both developing and adult testis.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C368(2.04) | LDD2266 | [1] | |
Competitor(s) Related to This Target