Details of the Target
General Information of Target
| Target ID | LDTP15572 | |||||
|---|---|---|---|---|---|---|
| Target Name | Proteasome subunit alpha-type 8 (PSMA8) | |||||
| Gene Name | PSMA8 | |||||
| Gene ID | 143471 | |||||
| Synonyms |
PSMA7L; Proteasome subunit alpha-type 8; Proteasome alpha 4 subunit; Alpha4s; Proteasome subunit alpha-type 7-like |
|||||
| 3D Structure | ||||||
| Sequence |
MGKPWLRALQLLLLLGASWARAGAPRCTYTFVLPPQKFTGAVCWSGPASTRATPEAANAS
ELAALRMRVGRHEELLRELQRLAAADGAVAGEVRALRKESRGLSARLGQLRAQLQHEAGP GAGPGADLGAEPAAALALLGERVLNASAEAQRAAARFHQLDVKFRELAQLVTQQSSLIAR LERLCPGGAGGQQQVLPPPPLVPVVPVRLVGSTSDTSRMLDPAPEPQRDQTQRQQEPMAS PMPAGHPAVPTKPVGPWQDCAEARQAGHEQSGVYELRVGRHVVSVWCEQQLEGGGWTVIQ RRQDGSVNFFTTWQHYKAGFGRPDGEYWLGLEPVYQLTSRGDHELLVLLEDWGGRGARAH YDGFSLEPESDHYRLRLGQYHGDAGDSLSWHNDKPFSTVDRDRDSYSGNCALYQRGGWWY HACAHSNLNGVWHHGGHYRSRYQDGVYWAEFRGGAYSLRKAAMLIRPLKL |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Peptidase T1A family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Component of the spermatoproteasome, a proteasome specifically found in testis that promotes acetylation-dependent degradation of histones, thereby participating actively to the exchange of histones during spermatogenesis. The proteasome is a protein complex that degrades unneeded or damaged proteins by proteolysis, a chemical reaction that breaks peptide bonds. Required for 20S core proteasome assembly, essential for the degradation of meiotic proteins RAD51 and RPA1 at late prophase I and the progression of meiosis I during spermatogenesis. Localizes to the synaptonemal complex, a 'zipper'-like structure that holds homologous chromosome pairs in synapsis during meiotic prophase I.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
TH211 Probe Info |
![]() |
Y126(12.81); Y161(20.00); Y153(6.74) | LDD0260 | [1] | |
|
TH216 Probe Info |
![]() |
Y126(17.85); Y114(11.93); Y153(11.26); Y161(8.68) | LDD0259 | [1] | |
|
HHS-475 Probe Info |
![]() |
Y126(1.03); Y23(3.06) | LDD0264 | [2] | |
|
HHS-465 Probe Info |
![]() |
Y114(8.78); Y126(9.00); Y161(10.00); Y23(7.38) | LDD2237 | [3] | |
|
ATP probe Probe Info |
![]() |
N.A. | LDD0035 | [4] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0116 | HHS-0101 | DM93 | Y126(1.03); Y23(3.06) | LDD0264 | [2] |
| LDCM0117 | HHS-0201 | DM93 | Y126(0.96); Y23(1.77) | LDD0265 | [2] |
| LDCM0118 | HHS-0301 | DM93 | Y126(1.01); Y23(2.89) | LDD0266 | [2] |
| LDCM0119 | HHS-0401 | DM93 | Y126(1.24); Y23(2.10) | LDD0267 | [2] |
| LDCM0120 | HHS-0701 | DM93 | Y126(1.11); Y23(1.48) | LDD0268 | [2] |
References





