Details of the Target
General Information of Target
| Target ID | LDTP15570 | |||||
|---|---|---|---|---|---|---|
| Target Name | Ly6/PLAUR domain-containing protein 6B (LYPD6B) | |||||
| Gene Name | LYPD6B | |||||
| Gene ID | 130576 | |||||
| Synonyms |
Ly6/PLAUR domain-containing protein 6B |
|||||
| 3D Structure | ||||||
| Sequence |
MGASVSRGRAARVPAPEPEPEEALDLSQLPPELLLVVLSHVPPRTLLGRCRQVCRGWRAL
VDGQALWLLILARDHGATGRALLHLARSCQSPARNARPCPLGRFCARRPIGRNLIRNPCG QEGLRKWMVQHGGDGWVVEENRTTVPGAPSQTCFVTSFSWCCKKQVLDLEEEGLWPELLD SGRIEICVSDWWGARHDSGCMYRLLVQLLDANQTVLDKFSAVPDPIPQWNNNACLHVTHV FSNIKMGVRFVSFEHRGQDTQFWAGHYGARVTNSSVIVRVRLS |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
Likely acts as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro acts on nAChRs in a subtype- and stoichiometry-dependent manner. Modulates specifically alpha-3(3):beta-4(2) nAChRs by enhancing the sensitivity to ACh, decreasing ACh-induced maximal current response and increasing the rate of desensitization to ACh; has no effect on alpha-7 homomeric nAChRs; modulates alpha-3(2):alpha-5:beta-4(2) nAChRs in the context of CHRNA5/alpha-5 variant Asn-398 but not its wild-type sequence. However, according to another report in vitro it can weakly inhibits alpha-7 nAChRs.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C155(1.53) | LDD3380 | [1] | |
Competitor(s) Related to This Target

