Details of the Target
General Information of Target
| Target ID | LDTP15361 | |||||
|---|---|---|---|---|---|---|
| Target Name | Protein Aster-C (GRAMD1C) | |||||
| Gene Name | GRAMD1C | |||||
| Gene ID | 54762 | |||||
| Synonyms |
Protein Aster-C; GRAM domain-containing protein 1C |
|||||
| 3D Structure | ||||||
| Sequence |
MQKSCEENEGKPQNMPKAEEDRPLEDVPQEAEGNPQPSEEGVSQEAEGNPRGGPNQPGQG
FKEDTPVRHLDPEEMIRGVDELERLREEIRRVRNKFVMMHWKQRHSRSRPYPVCFRP |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Subcellular location |
Endoplasmic reticulum membrane
|
|||||
| Function |
Cholesterol transporter that mediates non-vesicular transport of cholesterol from the plasma membrane (PM) to the endoplasmic reticulum (ER). Contains unique domains for binding cholesterol and the PM, thereby serving as a molecular bridge for the transfer of cholesterol from the PM to the ER. Plays a crucial role in cholesterol homeostasis and has the unique ability to localize to the PM based on the level of membrane cholesterol. In lipid-poor conditions localizes to the ER membrane and in response to excess cholesterol in the PM is recruited to the endoplasmic reticulum-plasma membrane contact sites (EPCS) which is mediated by the GRAM domain. At the EPCS, the sterol-binding VASt/ASTER domain binds to the cholesterol in the PM and facilitates its transfer from the PM to ER.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C396(1.16) | LDD3224 | [1] | |
|
CY-1 Probe Info |
 |
N.A. | LDD0246 | [2] | |
|
YN-1 Probe Info |
 |
N.A. | LDD0447 | [3] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
References