Details of the Target
General Information of Target
| Target ID | LDTP15185 | |||||
|---|---|---|---|---|---|---|
| Target Name | BICD family-like cargo adapter 1 (BICDL1) | |||||
| Gene Name | BICDL1 | |||||
| Gene ID | 92558 | |||||
| Synonyms |
BICDR1; CCDC64; BICD family-like cargo adapter 1; Bicaudal D-related protein 1; BICD-related protein 1; BICDR-1; Coiled-coil domain-containing protein 64A; CCDC64A |
|||||
| 3D Structure | ||||||
| Sequence |
MALPHDSNETSYLLPPNNEDWGRQTIPDFVYGQKDLMAEGIQWPRNAPGIPDALPQSPFD
AALCSAWKQRVELGLFRYRLRELQTQILPGAVGFVAQLNVERGVQRRPPQTIKSVRQAFD PVQFNFNKIRPGEVLFRLHREPDLPGTLLQEDILVVINVSPLEWGHVLLVPEPARQLPQR LLPGALRAGIEAVLLSLHPGFRVGFNSLGGLASVNHLHLHGYYLAHRLPVEQAPSEPLDP GGHLHLLQDLPAPGFLFYTRGPGPDLESLISRVCRATDYLTDHEIAHNLFVTRGAPPGKT SPSSALTGVRVILWARKSSFGIKDGEAFNVALCELAGHLPVKTSQDFSSLTEAAAVALIQ DCRLPPSQAEDVQAALVALMSQEEQ |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
BICDR family
|
|||||
| Subcellular location |
Cytoplasm, cytoskeleton
|
|||||
| Function |
Acts as an adapter protein linking the dynein motor complex to various cargos and converts dynein from a non-processive to a highly processive motor in the presence of dynactin. Facilitates the interaction between dynein and dynactin and activates dynein processivity (the ability to move along a microtubule for a long distance without falling off the track). Predominantly recruits 2 dyneins, which increases both the force and speed of the microtubule motor. Component of secretory vesicle machinery in developing neurons that acts as a regulator of neurite outgrowth. Regulates the secretory vesicle transport by controlling the accumulation of Rab6-containing secretory vesicles in the pericentrosomal region restricting anterograde secretory transport during the early phase of neuronal differentiation, thereby inhibiting neuritogenesis.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
![]() |
C547(6.63) | LDD1706 | [1] | |
|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2224 | [2] | |
Competitor(s) Related to This Target
References


