Details of the Target
General Information of Target
| Target ID | LDTP15146 | |||||
|---|---|---|---|---|---|---|
| Target Name | Transmembrane and coiled-coil domain-containing protein 3 (TMCO3) | |||||
| Gene Name | TMCO3 | |||||
| Gene ID | 55002 | |||||
| Synonyms |
C13orf11; Transmembrane and coiled-coil domain-containing protein 3; Putative LAG1-interacting protein |
|||||
| 3D Structure | ||||||
| Sequence |
MPLTPEPPSGRVEGPPAWEAAPWPSLPCGPCIPIMLVLATLAALFILTTAVLAERLFRRA
LRPDPSHRAPTLVWRPGGELWIEPMGTARERSEDWYGSAVPLLTDRAPEPPTQVGTLEAR ATAPPAPSAPNSAPSNLGPQTVLEVPARSTFWGPQPWEGRPPATGLVSWAEPEQRPEASV QFGSPQARRQRPGSPDPEWGLQPRVTLEQISAFWKREGRTSVGF |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Monovalent cation:proton antiporter 2 (CPA2) transporter (TC 2.A.37) family
|
|||||
| Subcellular location |
Membrane
|
|||||
| Function | Probable Na(+)/H(+) antiporter. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C667(1.82) | LDD2337 | [1] | |
|
TFBX Probe Info |
![]() |
N.A. | LDD0027 | [2] | |
|
Acrolein Probe Info |
![]() |
H269(0.00); H25(0.00) | LDD0217 | [3] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0108 | Chloroacetamide | HeLa | N.A. | LDD0222 | [3] |
| LDCM0107 | IAA | HeLa | N.A. | LDD0221 | [3] |
| LDCM0022 | KB02 | HCC1187 | C667(1.82) | LDD2337 | [1] |
| LDCM0023 | KB03 | HCC1187 | C667(8.26) | LDD2754 | [1] |
| LDCM0024 | KB05 | HCC1187 | C667(5.35) | LDD3171 | [1] |
| LDCM0109 | NEM | HeLa | N.A. | LDD0223 | [3] |
References



