Details of the Target
General Information of Target
Target ID | LDTP15134 | |||||
---|---|---|---|---|---|---|
Target Name | Solute carrier family 25 member 47 (SLC25A47) | |||||
Gene Name | SLC25A47 | |||||
Gene ID | 283600 | |||||
Synonyms |
C14orf68; HDMCP; Solute carrier family 25 member 47; Hepatocellular carcinoma down-regulated mitochondrial carrier protein; Mitochondrial NAD(+) transporter SLC25A47 |
|||||
3D Structure | ||||||
Sequence |
MQMARLLGLCAWARKSVRMASSRMTRRDPLTNKVALVTASTDGIGFAIARRLAQDRAHVV
VSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVAMAVKLHGGIDILVSNAAVN PFFGSLMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFS PYNVSKTALLGLNNTLAIELAPRNIRVNCLHLDLSRLASAGCSGWTRKKRKA |
|||||
Target Bioclass |
Transporter and channel
|
|||||
Family |
Mitochondrial carrier (TC 2.A.29) family
|
|||||
Subcellular location |
Mitochondrion inner membrane
|
|||||
Function |
Mitochondrial NAD(+) transporter that acts as a 'metabolic gate' in hepatic lipogenesis. Provides NAD(+) substrate to mitochondrial SIRT3 deacetylase and enables its NAD(+)-dependent activities in mitochondrial energy metabolism. This triggers downstream activation of PRKAA1/AMPK-alpha signaling cascade that negatively regulates sterol regulatory element-binding protein (SREBP) transcriptional activities and ATP-consuming lipogenesis to restore cellular energy balance. May transport other mitochondrial metabolites having an aromatic nucleotide and phosphate groups, such as acetyl-CoA. Does not transport amino acids. The transport mechanism remains to be elucidated.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
BTD Probe Info |
![]() |
C165(0.65) | LDD2100 | [1] |
Competitor(s) Related to This Target