Details of the Target
General Information of Target
| Target ID | LDTP15121 | |||||
|---|---|---|---|---|---|---|
| Target Name | GTPase IMAP family member 6 (GIMAP6) | |||||
| Gene Name | GIMAP6 | |||||
| Gene ID | 474344 | |||||
| Synonyms |
IAN2; IAN6; GTPase IMAP family member 6; Immunity-associated nucleotide 2 protein; IAN-2; hIAN2; Immunity-associated nucleotide 6 protein; IAN-6; hIAN6 |
|||||
| 3D Structure | ||||||
| Sequence |
MQAPRAALVFALVIALVPVGRGNYEELENSGDTTVESERPNKVTIPSTFAAVTIKETLNA
NINSTNFAPDENQLEFILMVLIPLILLVLLLLSVVFLATYYKRKRTKQEPSSQGSQSALQ TYELGSENVKVPIFEEDTPSVMEIEMEELDKWMNSMNRNADFECLPTLKEEKESNHNPSD SES |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily, AIG1/Toc34/Toc159-like paraseptin GTPase family, IAN subfamily
|
|||||
| Subcellular location |
Cytoplasm, cytosol
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C197(11.77) | LDD0209 | [1] | |
|
4-Iodoacetamidophenylacetylene Probe Info |
 |
N.A. | LDD0038 | [2] | |
|
IA-alkyne Probe Info |
 |
C113(0.00); C197(0.00) | LDD0036 | [2] | |
|
Lodoacetamide azide Probe Info |
 |
N.A. | LDD0037 | [2] | |
Competitor(s) Related to This Target
References