Details of the Target
General Information of Target
Target ID | LDTP15096 | |||||
---|---|---|---|---|---|---|
Target Name | S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase TYW1B (TYW1B) | |||||
Gene Name | TYW1B | |||||
Gene ID | 441250 | |||||
Synonyms |
RSAFD2; S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase TYW1B; EC 4.1.3.44; Radical S-adenosyl methionine and flavodoxin domain-containing protein 2; tRNA wybutosine-synthesizing protein 1 homolog B
|
|||||
3D Structure | ||||||
Sequence |
MVSWMISRAVVLVFGMLYPAYYSYKAVKTKNVKEYVRWMMYWIVFALYTVIETVADQTVA
WFPLYYELKIAFVIWLLSPYTKGASLIYRKFLHPLLSSKEREIDDYIVQAKERGYETMVN FGRQGLNLAATAAVTAAVKSQGAITERLRSFSMHDLTTIQGDEPVGQRPYQPLPEAKKKS KPAPSESAGYGIPLKDGDEKTDEEAEGPYSDNEMLTHKGLRRSQSMKSVKTTKGRKEVRY GSLKYKVKKRPQVYF |
|||||
Target Bioclass |
Enzyme
|
|||||
Family |
TYW1 family
|
|||||
Function |
Probable component of the wybutosine biosynthesis pathway. Wybutosine is a hyper modified guanosine with a tricyclic base found at the 3'-position adjacent to the anticodon of eukaryotic phenylalanine tRNA. Catalyzes the condensation of N-methylguanine with 2 carbon atoms from pyruvate to form the tricyclic 4-demethylwyosine, an intermediate in wybutosine biosynthesis.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Target Site Mutations in Different Cell Lines
Cell line | Mutation details | Probe for labeling this protein in this cell | |||
---|---|---|---|---|---|
HT115 | SNV: p.E78Ter | . | |||
JURKAT | SNV: p.W104Ter | . | |||
LUDLU1 | SNV: p.G599C | . | |||
MCC13 | SNV: p.H259Y | DBIA Probe Info | |||
NCIH146 | SNV: p.N143Y | DBIA Probe Info | |||
NCIH2286 | Substitution: p.R164L | . | |||
NUGC3 | SNV: p.S443F | . | |||
SNU423 | SNV: p.D519Y | . | |||
SW756 | SNV: p.N449Y | . |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
DBIA Probe Info |
![]() |
C215(1.34) | LDD3314 | [1] | |
IPM Probe Info |
![]() |
C440(5.00) | LDD1702 | [2] | |
Lodoacetamide azide Probe Info |
![]() |
N.A. | LDD0037 | [3] | |
NAIA_5 Probe Info |
![]() |
C215(0.00); C416(0.00) | LDD2223 | [4] |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
References