Details of the Target
General Information of Target
| Target ID | LDTP15070 | |||||
|---|---|---|---|---|---|---|
| Target Name | Zinc finger protein 660 (ZNF660) | |||||
| Gene Name | ZNF660 | |||||
| Gene ID | 285349 | |||||
| Synonyms |
Zinc finger protein 660 |
|||||
| 3D Structure | ||||||
| Sequence |
MVQIIKDTNEFKTFLTAAGHKLAVVQFSSKRCGPCKRMFPVFHAMSVKYQNVFFANVDVN
NSPELAETCHIKTIPTFQMFKKSQKVTLFSRIKRIICCYRSGFMSNLIFEFCGADAKKLE AKTQELM |
|||||
| Target Bioclass |
Transcription factor
|
|||||
| Family |
Krueppel C2H2-type zinc-finger protein family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function | May be involved in transcriptional regulation. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
HHS-465 Probe Info |
![]() |
K76(0.00); K79(0.00); Y78(0.00) | LDD2240 | [1] | |

