Details of the Target
General Information of Target
| Target ID | LDTP15068 | |||||
|---|---|---|---|---|---|---|
| Target Name | Putative 3-phosphoinositide-dependent protein kinase 2 (PDPK2P) | |||||
| Gene Name | PDPK2P | |||||
| Synonyms |
PDPK2; Putative 3-phosphoinositide-dependent protein kinase 2; EC 2.7.11.1; 3-phosphoinositide-dependent protein kinase 2 pseudogene |
|||||
| 3D Structure | ||||||
| Sequence |
MPAGVPMSTYLKMFAASLLAMCAGAEVVHRYYRPDLTIPEIPPKRGELKTELLGLKERKH
KPQVSQQEELK |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Protein kinase superfamily, AGC Ser/Thr protein kinase family, PDPK1 subfamily
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function | Phosphorylates and activates not only PKB/AKT, but also PKA, PKC-zeta, RPS6KA1 and RPS6KB1. May play a general role in signaling processes and in development. | |||||
| Uniprot ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IPM Probe Info |
 |
C154(0.00); C300(0.00) | LDD0241 | [1] | |
|
DBIA Probe Info |
 |
C181(1.85) | LDD3440 | [2] | |
|
W1 Probe Info |
 |
N.A. | LDD0236 | [1] | |
Competitor(s) Related to This Target
References