Details of the Target
General Information of Target
| Target ID | LDTP15040 | |||||
|---|---|---|---|---|---|---|
| Target Name | GTPase-activating Rap/Ran-GAP domain-like protein 3 (GARNL3) |
|
||||
| Gene Name | GARNL3 | |||||
| Gene ID | 84253 | |||||
| Synonyms |
GTPase-activating Rap/Ran-GAP domain-like protein 3 |
|||||
| 3D Structure | ||||||
| Sequence |
MSLQKTPPTRVFVELVPWADRSRENNLASGRETLPGLRHPLSSTQAQTATREVQVSGTSE
VSAGPDRAQVVVRVSSTKEAAAEAKKSVCRRLDYITQSLQQQGVQAENITVTKDFRRVEN AYHMEAEVCITFTEFGKMQNICNFLVEKLDSSVVISPPQFYHTPGSVENLRRQACLVAVE NAWRKAQEVCNLVGQTLGKPLLIKEEETKEWEGQIDDHQSSRLSSSLTVQQKIKSATIHA ASKVFITFEVKGKEKRKKHL |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
GARNL3 family
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
| Cell line | Mutation details | Probe for labeling this protein in this cell | |||
|---|---|---|---|---|---|
| CASKI | SNV: p.E312K | . | |||
| CCK81 | SNV: p.I724V | . | |||
| DOTC24510 | SNV: p.R83Q | . | |||
| G415 | SNV: p.S847P | . | |||
| HCC1937 | SNV: p.D401H | . | |||
| HEC1 | SNV: p.R396C | DBIA Probe Info | |||
| HEC1B | SNV: p.R396C | . | |||
| KARPAS422 | SNV: p.S847Ter | . | |||
| KYSE180 | Substitution: p.P390S | . | |||
| REH | Deletion: p.L104Ter | . | |||
| SH4 | SNV: p.L543R | . | |||
| SUPT1 | Deletion: p.L104Ter | . | |||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
ONAyne Probe Info |
 |
K395(3.72) | LDD0275 | [1] | |
|
DBIA Probe Info |
 |
C152(2.57) | LDD3340 | [2] | |
|
Acrolein Probe Info |
 |
N.A. | LDD0222 | [3] | |
|
IPM Probe Info |
 |
N.A. | LDD2156 | [4] | |
|
STPyne Probe Info |
 |
N.A. | LDD0009 | [5] | |
Competitor(s) Related to This Target
References